PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010938113.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 291aa    MW: 33475.5 Da    PI: 5.1428
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010938113.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.12.9e-52141411128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeelvv+yL++kv+++ l++  +i+evd+yk++PwdLp+k+  ++kewyfF++rd+ky++g+r+nra+++gyWkatg dk+v+  
  XP_010938113.1  14 LPPGFRFHPTDEELVVHYLCRKVAKQCLPV-PIIAEVDLYKYDPWDLPEKALFGQKEWYFFTPRDRKYPNGSRPNRAAERGYWKATGADKPVTPP 107
                     79****************************.88***************8888899**************************************99 PP

             NAM  96 .kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      +++  g+kk+Lvfy+g+a+k++ktdW+mheyrl
  XP_010938113.1 108 gSNRPLGIKKSLVFYNGKASKAVKTDWIMHEYRL 141
                     66778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-629167IPR003441NAC domain
PROSITE profilePS5100559.96314167IPR003441NAC domain
PfamPF023658.7E-2815141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MMGRRRDAEA ELNLPPGFRF HPTDEELVVH YLCRKVAKQC LPVPIIAEVD LYKYDPWDLP  60
EKALFGQKEW YFFTPRDRKY PNGSRPNRAA ERGYWKATGA DKPVTPPGSN RPLGIKKSLV  120
FYNGKASKAV KTDWIMHEYR LADTNRVANK NNGGRLDDWV LCRLYNKKNN WEKMQRQKEK  180
EEGSLGEMMD SMEASESFRT PESDIETEVF PDFDSLGQVG AQLYQAFDGV EAMRTSNTGS  240
FQMVERQKED SDWFSDLYLD DLQSFSAAFG ATPAIDTSNQ EYYFSTIGSP F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-9221733174Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010938113.10.0PREDICTED: NAC domain-containing protein 68-like
SwissprotQ52QH41e-110NAC68_ORYSJ; NAC domain-containing protein 68
TrEMBLQ2XQF61e-155Q2XQF6_ELAGV; NAC protein 1
STRINGGSMUA_Achr7P21780_0011e-142(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP53893761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77450.11e-87NAC domain containing protein 32